SCOPe 2.08: Domain d4x6da2: 4x6d A:184-278

Lineage for d4x6da2 (4x6d A:184-278)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein CD1, alpha-3 domain [88615] (5 species)
Species Human (Homo sapiens), CD1b [TaxId:9606] [88617] (10 PDB entries)

Domain d4x6da2: 4x6d A:184-278 [269544]
Other proteins in same PDB: d4x6da1, d4x6db_, d4x6dc1, d4x6dd_, d4x6de1, d4x6de2, d4x6df1, d4x6df2, d4x6dg1, d4x6dg2, d4x6dh1, d4x6dh2
automated match to d1gzqa1
complexed with ola, pam

Details for d4x6da2

PDB Entry: 4x6d (more details), 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr

PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x6da2 b.1.1.2 (A:184-278) CD1, alpha-3 domain {Human (Homo sapiens), CD1b [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywe

SCOPe Domain Coordinates for d4x6da2:

Click to download the PDB-style file with coordinates for d4x6da2.
(The format of our PDB-style files is described here.)

Timeline for d4x6da2: