Lineage for d4x6da1 (4x6d A:7-183)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937553Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2937580Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (17 PDB entries)
  8. 2937598Domain d4x6da1: 4x6d A:7-183 [269543]
    Other proteins in same PDB: d4x6da2, d4x6db_, d4x6dd_, d4x6de1, d4x6de2, d4x6df1, d4x6df2, d4x6dg1, d4x6dg2, d4x6dh1, d4x6dh2
    automated match to d3t8xa1
    complexed with ola, pam

Details for d4x6da1

PDB Entry: 4x6d (more details), 2.98 Å

PDB Description: cd1a ternary complex with endogenous lipids and bk6 tcr
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d4x6da1:

Sequence, based on SEQRES records: (download)

>d4x6da1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Sequence, based on observed residues (ATOM records): (download)

>d4x6da1 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
plsfhviwiasfkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkeletlfr
irtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsfqnnsw
lpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

SCOPe Domain Coordinates for d4x6da1:

Click to download the PDB-style file with coordinates for d4x6da1.
(The format of our PDB-style files is described here.)

Timeline for d4x6da1: