![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
![]() | Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (15 PDB entries) |
![]() | Domain d4x6dc1: 4x6d C:7-183 [269542] Other proteins in same PDB: d4x6da2, d4x6db_, d4x6dd_, d4x6de1, d4x6de2, d4x6df1, d4x6df2, d4x6dg1, d4x6dg2, d4x6dh1, d4x6dh2 automated match to d3t8xa1 complexed with ola, pam |
PDB Entry: 4x6d (more details), 2.98 Å
SCOPe Domain Sequences for d4x6dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x6dc1 d.19.1.1 (C:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]} plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d4x6dc1: