Lineage for d1dro__ (1dro -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (11 proteins) 
Protein beta-spectrin [50733] (2 species) 
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50735] (1 PDB entry) 
Domain d1dro__: 1dro - [26954]
Details for d1dro__
PDB Entry: 1dro (more details)
PDB Description: nmr structure of the cytoskeleton/signal transduction protein
SCOP Domain Sequences for d1dro__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dro__ b.55.1.1 (-) beta-spectrin {Fruit fly (Drosophila melanogaster)}
gsgtgageghegyvtrkhewdsttkkasnrswdkvymaakagrisfykdqkgyksnpelt
frgepsydlqnaaieiasdytkkkhvlrvklangalfllqahddtemsqwvtslkaqsds
ta
SCOP Domain Coordinates for d1dro__:
Click to download the PDB-style file with coordinates for d1dro__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dro__:
- d1dro__ first appeared (with stable ids) in SCOP 1.55
- d1dro__ appears in SCOP 1.57
- d1dro__ appears in SCOP 1.61
- d1dro__ appears in the current release, SCOPe 2.08, called d1droa_
View in 3D