Lineage for d4wzbh_ (4wzb H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869228Protein Nitrogenase iron protein [52661] (3 species)
  7. 2869232Species Azotobacter vinelandii [TaxId:354] [52662] (26 PDB entries)
  8. 2869261Domain d4wzbh_: 4wzb H: [269538]
    Other proteins in same PDB: d4wzba_, d4wzbb_, d4wzbc_, d4wzbd_
    automated match to d2afif_
    complexed with acp, clf, fe2, hca, ics, mg, sf4

Details for d4wzbh_

PDB Entry: 4wzb (more details), 2.3 Å

PDB Description: crystal structure of mgamppcp-bound av2-av1 complex
PDB Compounds: (H:) nitrogenase iron protein 1

SCOPe Domain Sequences for d4wzbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wzbh_ c.37.1.10 (H:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmd

SCOPe Domain Coordinates for d4wzbh_:

Click to download the PDB-style file with coordinates for d4wzbh_.
(The format of our PDB-style files is described here.)

Timeline for d4wzbh_: