Lineage for d4wswf_ (4wsw F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1970237Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 1970238Protein automated matches [254645] (10 species)
    not a true protein
  7. 1970267Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries)
  8. 1970275Domain d4wswf_: 4wsw F: [269529]
    Other proteins in same PDB: d4wswa_, d4wswc_, d4wswe_
    automated match to d4uo4b_
    complexed with nag

Details for d4wswf_

PDB Entry: 4wsw (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin from a/green-winged teal/texas/y171/2006 influenza virus
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wswf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wswf_ h.3.1.0 (F:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln

SCOPe Domain Coordinates for d4wswf_:

Click to download the PDB-style file with coordinates for d4wswf_.
(The format of our PDB-style files is described here.)

Timeline for d4wswf_: