| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (10 species) not a true protein |
| Species Influenza A virus [TaxId:11320] [255657] (7 PDB entries) |
| Domain d4wswd_: 4wsw D: [269527] Other proteins in same PDB: d4wswa_, d4wswc_, d4wswe_ automated match to d4uo4b_ complexed with nag |
PDB Entry: 4wsw (more details), 2.8 Å
SCOPe Domain Sequences for d4wswd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wswd_ h.3.1.0 (D:) automated matches {Influenza A virus [TaxId: 11320]}
glfgaiagfiengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrliektn
tefesiesefseiehqigniinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhkcddncmesirnntydhtqyreeallnrln
Timeline for d4wswd_: