SCOPe 2.08: Domain d4wstg1: 4wst G:1-324

Lineage for d4wstg1 (4wst G:1-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)

8. Domain d4wstg1: 4wst G:1-324 [269517]
   Other proteins in same PDB: d4wsta2, d4wstb_, d4wstc2, d4wstd_, d4wste2, d4wstf_, d4wstg2, d4wsth_, d4wsti2, d4wstj_, d4wstk2, d4wstl_
   automated match to d4fiua1
   complexed with nag

Details for d4wstg1

PDB Entry: 4wst, 2.4 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 influenza virus

PDB Compounds: (G:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wstg1:

Sequence; same for both SEQRES and ATOM records:

>d4wstg1 b.19.1.0 (G:1-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvp

Timeline for d4wstg1:

• d4wstg1 first appeared in SCOPe 2.05, called d4wstg_
  
• d4wstg1 appears in SCOPe 2.07