Lineage for d4wstd_ (4wst D:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267482Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)
  8. 2267528Domain d4wstd_: 4wst D: [269513]
    Other proteins in same PDB: d4wsta1, d4wsta2, d4wstc1, d4wstc2, d4wste1, d4wste2, d4wstg1, d4wstg2, d4wsti1, d4wsti2, d4wstk1, d4wstk2
    automated match to d4kthd_
    complexed with nag

Details for d4wstd_

PDB Entry: 4wst (more details), 2.4 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 influenza virus
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wstd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wstd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

SCOPe Domain Coordinates for d4wstd_:

Click to download the PDB-style file with coordinates for d4wstd_.
(The format of our PDB-style files is described here.)

Timeline for d4wstd_: