Lineage for d1mai__ (1mai -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 169555Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 169556Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 169557Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (14 proteins)
  6. 169613Protein Phospholipase C delta-1 [50731] (1 species)
  7. 169614Species Rat (Rattus norvegicus) [TaxId:10116] [50732] (1 PDB entry)
  8. 169615Domain d1mai__: 1mai - [26951]

Details for d1mai__

PDB Entry: 1mai (more details), 1.9 Å

PDB Description: structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate

SCOP Domain Sequences for d1mai__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mai__ b.55.1.1 (-) Phospholipase C delta-1 {Rat (Rattus norvegicus)}
glqddpdlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlfsied
iqevrmghrteglekfardipedrcfsivfkdqrntldliapspadaqhwvqglrkiih

SCOP Domain Coordinates for d1mai__:

Click to download the PDB-style file with coordinates for d1mai__.
(The format of our PDB-style files is described here.)

Timeline for d1mai__: