Lineage for d1maia_ (1mai A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803215Protein Phospholipase C delta-1 [50731] (1 species)
  7. 2803216Species Norway rat (Rattus norvegicus) [TaxId:10116] [50732] (1 PDB entry)
  8. 2803217Domain d1maia_: 1mai A: [26951]
    complexed with i3p

Details for d1maia_

PDB Entry: 1mai (more details), 1.9 Å

PDB Description: structure of the pleckstrin homology domain from phospholipase c delta in complex with inositol trisphosphate
PDB Compounds: (A:) phospholipase c delta-1

SCOPe Domain Sequences for d1maia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
glqddpdlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlfsied
iqevrmghrteglekfardipedrcfsivfkdqrntldliapspadaqhwvqglrkiih

SCOPe Domain Coordinates for d1maia_:

Click to download the PDB-style file with coordinates for d1maia_.
(The format of our PDB-style files is described here.)

Timeline for d1maia_: