Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries) |
Domain d4wsxn_: 4wsx N: [269501] Other proteins in same PDB: d4wsxa_, d4wsxc_, d4wsxe_, d4wsxg_, d4wsxi_, d4wsxk_, d4wsxm_, d4wsxo_, d4wsxq_, d4wsxs_, d4wsxu_, d4wsxw_ automated match to d4d00d_ complexed with nag |
PDB Entry: 4wsx (more details), 2.7 Å
SCOPe Domain Sequences for d4wsxn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsxn_ h.3.1.1 (N:) automated matches {Influenza A virus [TaxId: 11320]} glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
Timeline for d4wsxn_: