Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (23 species) not a true protein |
Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269456] (2 PDB entries) |
Domain d4wssf1: 4wss F:1-320 [269487] Other proteins in same PDB: d4wssa2, d4wssb2, d4wssc2, d4wssd2, d4wsse2, d4wssf2 automated match to d1ha0a1 complexed with nag, sia |
PDB Entry: 4wss (more details), 2.8 Å
SCOPe Domain Sequences for d4wssf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wssf1 b.19.1.0 (F:1-320) automated matches {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]} dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw igecpkyvkskslklatglr
Timeline for d4wssf1: