Lineage for d4wsse2 (4wss E:334-498)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969583Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries)
  8. 1969594Domain d4wsse2: 4wss E:334-498 [269485]
    Other proteins in same PDB: d4wssa1, d4wssb1, d4wssc1, d4wssd1, d4wsse1, d4wssf1
    automated match to d1ha0a2
    complexed with nag, sia

Details for d4wsse2

PDB Entry: 4wss (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998 in complex with lsta
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4wsse2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsse2 h.3.1.1 (E:334-498) Influenza hemagglutinin (stalk) {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
iagfieggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfea
vehefsnlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksq
lrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr

SCOPe Domain Coordinates for d4wsse2:

Click to download the PDB-style file with coordinates for d4wsse2.
(The format of our PDB-style files is described here.)

Timeline for d4wsse2: