SCOPe 2.05: Domain d4wssb2: 4wss B:340-497

Lineage for d4wssb2 (4wss B:340-497)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries)

8. Domain d4wssb2: 4wss B:340-497 [269483]
   Other proteins in same PDB: d4wssa1, d4wssb1, d4wssc1, d4wssd1, d4wsse1, d4wssf1
   automated match to d1ha0a2
   complexed with nag, sia

Details for d4wssb2

PDB Entry: 4wss, 2.8 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998 in complex with lsta

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4wssb2:

Sequence; same for both SEQRES and ATOM records:

>d4wssb2 h.3.1.1 (B:340-497) Influenza hemagglutinin (stalk) {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
ggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefs
nlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksqlrdnak
dlgngcfefwhkcdnecinsvkngtynypkyqeesrln

Timeline for d4wssb2:

• d4wssb2 is new in SCOPe 2.05-stable
  
• d4wssb2 appears in SCOPe 2.06
  
• d4wssb2 appears in the current release, SCOPe 2.08