Lineage for d4wssb2 (4wss B:340-497)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040843Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries)
  8. 3040851Domain d4wssb2: 4wss B:340-497 [269483]
    Other proteins in same PDB: d4wssa1, d4wssb1, d4wssc1, d4wssd1, d4wsse1, d4wssf1
    automated match to d1ha0a2
    complexed with nag

Details for d4wssb2

PDB Entry: 4wss (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998 in complex with lsta
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4wssb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wssb2 h.3.1.1 (B:340-497) Influenza hemagglutinin (stalk) {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
ggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefs
nlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksqlrdnak
dlgngcfefwhkcdnecinsvkngtynypkyqeesrln

SCOPe Domain Coordinates for d4wssb2:

Click to download the PDB-style file with coordinates for d4wssb2.
(The format of our PDB-style files is described here.)

Timeline for d4wssb2: