![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (8 species) trimer |
![]() | Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries) |
![]() | Domain d4wssd2: 4wss D:329-498 [269481] Other proteins in same PDB: d4wssa1, d4wssb1, d4wssc1, d4wssd1, d4wsse1, d4wssf1 automated match to d1ha0a2 complexed with nag, sia |
PDB Entry: 4wss (more details), 2.8 Å
SCOPe Domain Sequences for d4wssd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wssd2 h.3.1.1 (D:329-498) Influenza hemagglutinin (stalk) {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]} glfgaiagfieggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn tqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhe kvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr
Timeline for d4wssd2: