SCOPe 2.05: Domain d4wssd1: 4wss D:1-323

Lineage for d4wssd1 (4wss D:1-323)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269456] (2 PDB entries)

8. Domain d4wssd1: 4wss D:1-323 [269480]
   Other proteins in same PDB: d4wssa2, d4wssb2, d4wssc2, d4wssd2, d4wsse2, d4wssf2
   automated match to d1ha0a1
   complexed with nag, sia

Details for d4wssd1

PDB Entry: 4wss, 2.8 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998 in complex with lsta

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4wssd1:

Sequence; same for both SEQRES and ATOM records:

>d4wssd1 b.19.1.0 (D:1-323) automated matches {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
igecpkyvkskslklatglrnvp

Timeline for d4wssd1:

• d4wssd1 is new in SCOPe 2.05-stable
  
• d4wssd1 appears in SCOPe 2.06
  
• d4wssd1 appears in the current release, SCOPe 2.08