Lineage for d4wssd1 (4wss D:1-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776240Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269456] (2 PDB entries)
  8. 2776250Domain d4wssd1: 4wss D:1-323 [269480]
    Other proteins in same PDB: d4wssa2, d4wssb2, d4wssc2, d4wssd2, d4wsse2, d4wssf2
    automated match to d1ha0a1
    complexed with nag

Details for d4wssd1

PDB Entry: 4wss (more details), 2.8 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998 in complex with lsta
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4wssd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wssd1 b.19.1.0 (D:1-323) automated matches {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
igecpkyvkskslklatglrnvp

SCOPe Domain Coordinates for d4wssd1:

Click to download the PDB-style file with coordinates for d4wssd1.
(The format of our PDB-style files is described here.)

Timeline for d4wssd1: