Lineage for d1gsgp1 (1gsg P:339-547)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563797Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 563798Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 563809Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
  6. 563810Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 563811Species Escherichia coli [TaxId:562] [50721] (13 PDB entries)
  8. 563824Domain d1gsgp1: 1gsg P:339-547 [26948]
    Other proteins in same PDB: d1gsgp2
    protein/tRNA complex

Details for d1gsgp1

PDB Entry: 1gsg (more details), 2.8 Å

PDB Description: Structure of E.coli glutaminyl-tRNA synthetase complexed with trnagln and ATP at 2.8 Angstroms resolution

SCOP Domain Sequences for d1gsgp1:

Sequence, based on SEQRES records: (download)

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydagvihwvsaahalpveirly
drlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhst
aekpvfnrtvglrdt

SCOP Domain Coordinates for d1gsgp1:

Click to download the PDB-style file with coordinates for d1gsgp1.
(The format of our PDB-style files is described here.)

Timeline for d1gsgp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsgp2