Class b: All beta proteins [48724] (149 folds) |
Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) |
Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein) |
Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species) duplication, consists of two barrel domains with the swapping of N-terminal strands |
Species Escherichia coli [TaxId:562] [50721] (13 PDB entries) |
Domain d1gsgp1: 1gsg P:339-547 [26948] Other proteins in same PDB: d1gsgp2 protein/tRNA complex |
PDB Entry: 1gsg (more details), 2.8 Å
SCOP Domain Sequences for d1gsgp1:
Sequence, based on SEQRES records: (download)
>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli} apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf eregyfcldsrhstaekpvfnrtvglrdt
>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli} apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank qykrlvlgkevrlrnayvikaervekdaegnittifctydagvihwvsaahalpveirly drlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhst aekpvfnrtvglrdt
Timeline for d1gsgp1: