SCOPe 2.06: Domain d4wsuc1: 4wsu C:1-324

Lineage for d4wsuc1 (4wsu C:1-324)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [228462] (22 PDB entries)

8. Domain d4wsuc1: 4wsu C:1-324 [269475]
   Other proteins in same PDB: d4wsua2, d4wsub_, d4wsuc2, d4wsud_, d4wsue2, d4wsuf_
   automated match to d4fiua1
   complexed with gal, nag, sia

Details for d4wsuc1

PDB Entry: 4wsu, 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 3'sln

PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsuc1:

Sequence; same for both SEQRES and ATOM records:

>d4wsuc1 b.19.1.0 (C:1-324) automated matches {Influenza A virus [TaxId: 11320]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvp

Timeline for d4wsuc1:

• d4wsuc1 first appeared in SCOPe 2.05, called d4wsuc_
  
• d4wsuc1 appears in SCOPe 2.07
  
• d4wsuc1 appears in the current release, SCOPe 2.08