Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
Species Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries) |
Domain d4wssc2: 4wss C:340-498 [269474] Other proteins in same PDB: d4wssa1, d4wssb1, d4wssc1, d4wssd1, d4wsse1, d4wssf1 automated match to d1ha0a2 complexed with gal, nag, sia |
PDB Entry: 4wss (more details), 2.8 Å
SCOPe Domain Sequences for d4wssc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wssc2 h.3.1.1 (C:340-498) Influenza hemagglutinin (stalk) {Influenza a virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]} ggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefs nlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksqlrdnak dlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr
Timeline for d4wssc2: