Lineage for d4wsue_ (4wsu E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778763Species Influenza A virus [TaxId:11320] [228462] (15 PDB entries)
  8. 1778780Domain d4wsue_: 4wsu E: [269472]
    Other proteins in same PDB: d4wsub_, d4wsud_, d4wsuf_
    automated match to d4fiua1
    complexed with gal, nag, sia

Details for d4wsue_

PDB Entry: 4wsu (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 3'sln
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsue_ b.19.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
lwigecpkyvkseslrlatglrnvp

SCOPe Domain Coordinates for d4wsue_:

Click to download the PDB-style file with coordinates for d4wsue_.
(The format of our PDB-style files is described here.)

Timeline for d4wsue_:

  • d4wsue_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-26
  • d4wsue_ is called d4wsue1 in SCOPe 2.06
  • d4wsue_ appears in the current release, SCOPe 2.07, called d4wsue1