Lineage for d4wsue1 (4wsu E:1-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776720Domain d4wsue1: 4wsu E:1-324 [269472]
    Other proteins in same PDB: d4wsua2, d4wsub_, d4wsuc2, d4wsud_, d4wsue2, d4wsuf_
    automated match to d4fiua1
    complexed with nag, sia

Details for d4wsue1

PDB Entry: 4wsu (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 3'sln
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsue1 b.19.1.0 (E:1-324) automated matches {Influenza A virus, different strains [TaxId: 11320]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvp

SCOPe Domain Coordinates for d4wsue1:

Click to download the PDB-style file with coordinates for d4wsue1.
(The format of our PDB-style files is described here.)

Timeline for d4wsue1: