Lineage for d4wsub_ (4wsu B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041677Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 3041735Domain d4wsub_: 4wsu B: [269470]
    Other proteins in same PDB: d4wsua1, d4wsua2, d4wsuc1, d4wsuc2, d4wsue1, d4wsue2
    automated match to d4kthd_
    complexed with nag, sia

Details for d4wsub_

PDB Entry: 4wsu (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 3'sln
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsub_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnr

SCOPe Domain Coordinates for d4wsub_:

Click to download the PDB-style file with coordinates for d4wsub_.
(The format of our PDB-style files is described here.)

Timeline for d4wsub_: