Lineage for d1qrua1 (1qru A:339-547)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070856Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 2070857Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) (S)
  5. 2070919Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
    automatically mapped to Pfam PF03950
  6. 2070920Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
    duplication, consists of two barrel domains with the swapping of N-terminal strands
  7. 2070923Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)
  8. 2070937Domain d1qrua1: 1qru A:339-547 [26946]
    Other proteins in same PDB: d1qrua2
    protein/RNA complex; complexed with atp; mutant

Details for d1qrua1

PDB Entry: 1qru (more details), 3 Å

PDB Description: glutaminyl-trna synthetase mutant i129t complexed with glutamine transfer rna
PDB Compounds: (A:) protein (glutaminyl-tRNA synthetase (e.c.6.1.1.18))

SCOPe Domain Sequences for d1qrua1:

Sequence, based on SEQRES records: (download)

>d1qrua1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1qrua1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOPe Domain Coordinates for d1qrua1:

Click to download the PDB-style file with coordinates for d1qrua1.
(The format of our PDB-style files is described here.)

Timeline for d1qrua1: