Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry) |
Domain d4wsvf_: 4wsv F: [269455] Other proteins in same PDB: d4wsva1, d4wsva2, d4wsvc1, d4wsvc2, d4wsve1, d4wsve2 automated match to d4kthd_ complexed with nag, sia |
PDB Entry: 4wsv (more details), 3.1 Å
SCOPe Domain Sequences for d4wsvf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsvf_ h.3.1.1 (F:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
Timeline for d4wsvf_: