Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (23 species) not a true protein |
Species Influenza a virus h6n1 subtype [TaxId:119212] [269451] (1 PDB entry) |
Domain d4wsve_: 4wsv E: [269454] Other proteins in same PDB: d4wsvb_, d4wsvd_, d4wsvf_ automated match to d4fiua1 complexed with nag, sia |
PDB Entry: 4wsv (more details), 3.1 Å
SCOPe Domain Sequences for d4wsve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsve_ b.19.1.0 (E:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]} sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp lwigecpkyvkseslrlatglrnvp
Timeline for d4wsve_: