SCOPe 2.08: Domain d4wsve1: 4wsv E:1-324

Lineage for d4wsve1 (4wsv E:1-324)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus h6n1 subtype [TaxId:119212] [269451] (9 PDB entries)

8. Domain d4wsve1: 4wsv E:1-324 [269454]
   Other proteins in same PDB: d4wsva2, d4wsvb_, d4wsvc2, d4wsvd_, d4wsve2, d4wsvf_
   automated match to d4fiua1
   complexed with nag, sia

Details for d4wsve1

PDB Entry: 4wsv, 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsve1:

Sequence; same for both SEQRES and ATOM records:

>d4wsve1 b.19.1.0 (E:1-324) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvp

Timeline for d4wsve1:

• d4wsve1 first appeared in SCOPe 2.05, called d4wsve_
  
• d4wsve1 appears in SCOPe 2.07