SCOPe 2.05: Domain d4wsva_: 4wsv A:

Lineage for d4wsva_ (4wsv A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a virus h6n1 subtype [TaxId:119212] [269451] (1 PDB entry)

8. Domain d4wsva_: 4wsv A: [269453]
   Other proteins in same PDB: d4wsvb_, d4wsvd_, d4wsvf_
   automated match to d4fiua1
   complexed with nag, sia

Details for d4wsva_

PDB Entry: 4wsv, 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsva_:

Sequence; same for both SEQRES and ATOM records:

>d4wsva_ b.19.1.0 (A:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]}
sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
lwigecpkyvkseslrlatglrnvp

Timeline for d4wsva_:

• d4wsva_ is new in SCOPe 2.05-stable
  
• d4wsva_ is called d4wsva1 in SCOPe 2.06
  
• d4wsva_ appears in the current release, SCOPe 2.08, called d4wsva1