Lineage for d4wsva1 (4wsv A:1-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776489Species Influenza A virus h6n1 subtype [TaxId:119212] [269451] (9 PDB entries)
  8. 2776514Domain d4wsva1: 4wsv A:1-324 [269453]
    Other proteins in same PDB: d4wsva2, d4wsvb_, d4wsvc2, d4wsvd_, d4wsve2, d4wsvf_
    automated match to d4fiua1
    complexed with nag, sia

Details for d4wsva1

PDB Entry: 4wsv (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsva1 b.19.1.0 (A:1-324) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]}
dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw
ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks
twagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwgv
hhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget
lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvp

SCOPe Domain Coordinates for d4wsva1:

Click to download the PDB-style file with coordinates for d4wsva1.
(The format of our PDB-style files is described here.)

Timeline for d4wsva1: