Lineage for d4wsvc_ (4wsv C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778756Species Influenza a virus h6n1 subtype [TaxId:119212] [269451] (1 PDB entry)
  8. 1778758Domain d4wsvc_: 4wsv C: [269452]
    Other proteins in same PDB: d4wsvb_, d4wsvd_, d4wsvf_
    automated match to d4fiua1
    complexed with nag, sia

Details for d4wsvc_

PDB Entry: 4wsv (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsvc_ b.19.1.0 (C:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]}
sdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctieg
wilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpk
stwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfwg
vhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpge
tlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvsp
lwigecpkyvkseslrlatglrnvp

SCOPe Domain Coordinates for d4wsvc_:

Click to download the PDB-style file with coordinates for d4wsvc_.
(The format of our PDB-style files is described here.)

Timeline for d4wsvc_: