Lineage for d4wsvb_ (4wsv B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267478Species Influenza a virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry)
  8. 2267479Domain d4wsvb_: 4wsv B: [269450]
    Other proteins in same PDB: d4wsva1, d4wsva2, d4wsvc1, d4wsvc2, d4wsve1, d4wsve2
    automated match to d4kthd_
    complexed with nag, sia

Details for d4wsvb_

PDB Entry: 4wsv (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln
PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsvb_ h.3.1.1 (B:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

SCOPe Domain Coordinates for d4wsvb_:

Click to download the PDB-style file with coordinates for d4wsvb_.
(The format of our PDB-style files is described here.)

Timeline for d4wsvb_: