SCOPe 2.05: Domain d4wsvb_: 4wsv B:

Lineage for d4wsvb_ (4wsv B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry)

8. Domain d4wsvb_: 4wsv B: [269450]
   Other proteins in same PDB: d4wsva_, d4wsvc_, d4wsve_
   automated match to d4kthd_
   complexed with nag, sia

Details for d4wsvb_

PDB Entry: 4wsv, 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln

PDB Compounds: (B:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsvb_:

Sequence; same for both SEQRES and ATOM records:

>d4wsvb_ h.3.1.1 (B:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

Timeline for d4wsvb_:

• d4wsvb_ is new in SCOPe 2.05-stable
  
• d4wsvb_ appears in SCOPe 2.06
  
• d4wsvb_ appears in the current release, SCOPe 2.08