Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (33 species) not a true protein |
Species Influenza a virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry) |
Domain d4wsvb_: 4wsv B: [269450] Other proteins in same PDB: d4wsva_, d4wsvc_, d4wsve_ automated match to d4kthd_ complexed with nag, sia |
PDB Entry: 4wsv (more details), 3.1 Å
SCOPe Domain Sequences for d4wsvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsvb_ h.3.1.1 (B:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
Timeline for d4wsvb_: