SCOPe 2.05: Domain d4wsvd_: 4wsv D:

Lineage for d4wsvd_ (4wsv D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry)

8. Domain d4wsvd_: 4wsv D: [269449]
   Other proteins in same PDB: d4wsva_, d4wsvc_, d4wsve_
   automated match to d4kthd_
   complexed with nag, sia

Details for d4wsvd_

PDB Entry: 4wsv, 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsvd_:

Sequence; same for both SEQRES and ATOM records:

>d4wsvd_ h.3.1.1 (D:) automated matches {Influenza a virus h6n1 subtype [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

Timeline for d4wsvd_:

• d4wsvd_ is new in SCOPe 2.05-stable
  
• d4wsvd_ appears in SCOPe 2.06
  
• d4wsvd_ appears in the current release, SCOPe 2.08