Lineage for d4wsvd_ (4wsv D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041570Species Influenza A virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry)
  8. 3041572Domain d4wsvd_: 4wsv D: [269449]
    Other proteins in same PDB: d4wsva1, d4wsva2, d4wsvc1, d4wsvc2, d4wsve1, d4wsve2
    automated match to d4kthd_
    complexed with nag, sia

Details for d4wsvd_

PDB Entry: 4wsv (more details), 3.1 Å

PDB Description: the crystal structure of hemagglutinin from a/taiwan/1/2013 in complex with 6'sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsvd_ h.3.1.1 (D:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl

SCOPe Domain Coordinates for d4wsvd_:

Click to download the PDB-style file with coordinates for d4wsvd_.
(The format of our PDB-style files is described here.)

Timeline for d4wsvd_: