| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein automated matches [254646] (29 species) not a true protein |
| Species Influenza A virus h6n1 subtype [TaxId:119212] [269448] (1 PDB entry) |
| Domain d4wsvd_: 4wsv D: [269449] Other proteins in same PDB: d4wsva1, d4wsva2, d4wsvc1, d4wsvc2, d4wsve1, d4wsve2 automated match to d4kthd_ complexed with nag, sia |
PDB Entry: 4wsv (more details), 3.1 Å
SCOPe Domain Sequences for d4wsvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsvd_ h.3.1.1 (D:) automated matches {Influenza A virus h6n1 subtype [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkeskl
Timeline for d4wsvd_: