Lineage for d4wesd_ (4wes D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2161045Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2161099Protein Nitrogenase iron-molybdenum protein, beta chain [81401] (3 species)
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
  7. 2161152Species Clostridium pasteurianum [TaxId:1501] [81395] (5 PDB entries)
  8. 2161154Domain d4wesd_: 4wes D: [269446]
    Other proteins in same PDB: d4wesa_, d4wesc_
    automated match to d1miob_
    complexed with clf, fe2, hca, ics, mpd

Details for d4wesd_

PDB Entry: 4wes (more details), 1.08 Å

PDB Description: nitrogenase molybdenum-iron protein from clostridium pasteurianum at 1.08 a resolution
PDB Compounds: (D:) nitrogenase molybdenum-iron protein beta chain

SCOPe Domain Sequences for d4wesd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wesd_ c.92.2.3 (D:) Nitrogenase iron-molybdenum protein, beta chain {Clostridium pasteurianum [TaxId: 1501]}
mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
ynpkvgykgairlveeitnvildkierecteedfevvr

SCOPe Domain Coordinates for d4wesd_:

Click to download the PDB-style file with coordinates for d4wesd_.
(The format of our PDB-style files is described here.)

Timeline for d4wesd_: