Lineage for d4w1vb_ (4w1v B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149076Species Mycobacterium tuberculosis [TaxId:83331] [269439] (1 PDB entry)
  8. 2149078Domain d4w1vb_: 4w1v B: [269440]
    automated match to d4mqrb_
    complexed with 3gs, cl, edo, peg, plp

Details for d4w1vb_

PDB Entry: 4w1v (more details), 2.24 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor
PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d4w1vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w1vb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
vevarlvgs

SCOPe Domain Coordinates for d4w1vb_:

Click to download the PDB-style file with coordinates for d4w1vb_.
(The format of our PDB-style files is described here.)

Timeline for d4w1vb_: