SCOPe 2.07: Domain d1exda1: 1exd A:339-547

Lineage for d1exda1 (1exd A:339-547)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families)

5. Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
   automatically mapped to Pfam PF03950

6. Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (2 species)
   duplication, consists of two barrel domains with the swapping of N-terminal strands

7. Species Escherichia coli [TaxId:562] [50721] (17 PDB entries)

8. Domain d1exda1: 1exd A:339-547 [26944]
   Other proteins in same PDB: d1exda2
   protein/RNA complex; complexed with a, so4

Details for d1exda1

PDB Entry: 1exd, 2.7 Å

PDB Description: crystal structure of a tight-binding glutamine trna bound to glutamine aminoacyl trna synthetase

PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOPe Domain Sequences for d1exda1:

Sequence, based on SEQRES records:

>d1exda1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records):

>d1exda1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli [TaxId: 562]}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

Timeline for d1exda1:

• d1exda1 first appeared (with stable ids) in SCOP 1.55
  
• d1exda1 appears in SCOPe 2.06
  
• d1exda1 appears in the current release, SCOPe 2.08