Lineage for d4uxna3 (4uxn A:655-763)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895243Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1895244Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1895454Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1895478Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 1895479Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
    Uniprot O60341 655-763
  8. 1895501Domain d4uxna3: 4uxn A:655-763 [269432]
    Other proteins in same PDB: d4uxna1, d4uxna2, d4uxnb1, d4uxnb2
    automated match to d2xafa3
    complexed with fad, m8a

Details for d4uxna3

PDB Entry: 4uxn (more details), 2.85 Å

PDB Description: lsd1(kdm1a)-corest in complex with z-pro derivative of mc2580
PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d4uxna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxna3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOPe Domain Coordinates for d4uxna3:

Click to download the PDB-style file with coordinates for d4uxna3.
(The format of our PDB-style files is described here.)

Timeline for d4uxna3: