| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries) Uniprot O60341 655-763 |
| Domain d4uxna3: 4uxn A:655-763 [269432] Other proteins in same PDB: d4uxna1, d4uxna2, d4uxnb1, d4uxnb2 automated match to d2xafa3 complexed with fad, m8a |
PDB Entry: 4uxn (more details), 2.85 Å
SCOPe Domain Sequences for d4uxna3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uxna3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy
Timeline for d4uxna3: