Lineage for d4uxna1 (4uxn A:171-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692654Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 2692655Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 2692656Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
    Uniprot O60341 169-279
  8. 2692681Domain d4uxna1: 4uxn A:171-273 [269430]
    Other proteins in same PDB: d4uxna2, d4uxna3, d4uxnb1, d4uxnb2
    automated match to d2xafa1
    complexed with fad, m8a

Details for d4uxna1

PDB Entry: 4uxn (more details), 2.85 Å

PDB Description: lsd1(kdm1a)-corest in complex with z-pro derivative of mc2580
PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d4uxna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxna1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d4uxna1:

Click to download the PDB-style file with coordinates for d4uxna1.
(The format of our PDB-style files is described here.)

Timeline for d4uxna1: