![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries) |
![]() | Domain d4umea1: 4ume A:1-173 [269426] Other proteins in same PDB: d4umea2 automated match to d3n1ua_ complexed with kdo, mg |
PDB Entry: 4ume (more details), 2.09 Å
SCOPe Domain Sequences for d4umea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4umea1 c.108.1.0 (A:1-173) automated matches {Moraxella catarrhalis [TaxId: 857574]} mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq
Timeline for d4umea1: