SCOPe 2.06: Domain d4umfc1: 4umf C:1-173

Lineage for d4umfc1 (4umf C:1-173)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries)

8. Domain d4umfc1: 4umf C:1-173 [269424]
   Other proteins in same PDB: d4umfc2
   automated match to d3n1ua_
   complexed with kdo, mg, po4

Details for d4umfc1

PDB Entry: 4umf, 2.28 Å

PDB Description: crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule

PDB Compounds: (C:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC

SCOPe Domain Sequences for d4umfc1:

Sequence; same for both SEQRES and ATOM records:

>d4umfc1 c.108.1.0 (C:1-173) automated matches {Moraxella catarrhalis [TaxId: 857574]}
mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq

Timeline for d4umfc1:

• d4umfc1 first appeared in SCOPe 2.05, called d4umfc_
  
• d4umfc1 appears in SCOPe 2.07
  
• d4umfc1 appears in the current release, SCOPe 2.08