![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries) |
![]() | Domain d4umfd_: 4umf D: [269422] Other proteins in same PDB: d4umfc2 automated match to d3n1ua_ complexed with kdo, mg, po4 |
PDB Entry: 4umf (more details), 2.28 Å
SCOPe Domain Sequences for d4umfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4umfd_ c.108.1.0 (D:) automated matches {Moraxella catarrhalis [TaxId: 857574]} mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq
Timeline for d4umfd_:
![]() Domains from other chains: (mouse over for more information) d4umfa_, d4umfb_, d4umfc1, d4umfc2 |