Lineage for d4umfd_ (4umf D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920542Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries)
  8. 2920552Domain d4umfd_: 4umf D: [269422]
    Other proteins in same PDB: d4umfc2
    automated match to d3n1ua_
    complexed with kdo, mg, po4

Details for d4umfd_

PDB Entry: 4umf (more details), 2.28 Å

PDB Description: crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule
PDB Compounds: (D:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC

SCOPe Domain Sequences for d4umfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4umfd_ c.108.1.0 (D:) automated matches {Moraxella catarrhalis [TaxId: 857574]}
mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq

SCOPe Domain Coordinates for d4umfd_:

Click to download the PDB-style file with coordinates for d4umfd_.
(The format of our PDB-style files is described here.)

Timeline for d4umfd_: