Lineage for d4um5b_ (4um5 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920542Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries)
  8. 2920554Domain d4um5b_: 4um5 B: [269417]
    automated match to d3n1ua_
    complexed with edo, mg, po4

Details for d4um5b_

PDB Entry: 4um5 (more details), 2.34 Å

PDB Description: Crystal structure of 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Moraxella catarrhalis in complex with Magnesium ion and Phosphate ion
PDB Compounds: (B:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC

SCOPe Domain Sequences for d4um5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4um5b_ c.108.1.0 (B:) automated matches {Moraxella catarrhalis [TaxId: 857574]}
mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq

SCOPe Domain Coordinates for d4um5b_:

Click to download the PDB-style file with coordinates for d4um5b_.
(The format of our PDB-style files is described here.)

Timeline for d4um5b_: