SCOPe 2.07: Domain d4um5b_: 4um5 B:

Lineage for d4um5b_ (4um5 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (53 species)
   not a true protein

7. Species Moraxella catarrhalis [TaxId:857574] [269413] (5 PDB entries)

8. Domain d4um5b_: 4um5 B: [269417]
   automated match to d3n1ua_
   complexed with edo, mg, po4

Details for d4um5b_

PDB Entry: 4um5, 2.34 Å

PDB Description: Crystal structure of 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Moraxella catarrhalis in complex with Magnesium ion and Phosphate ion

PDB Compounds: (B:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC

SCOPe Domain Sequences for d4um5b_:

Sequence; same for both SEQRES and ATOM records:

>d4um5b_ c.108.1.0 (B:) automated matches {Moraxella catarrhalis [TaxId: 857574]}
mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq

Timeline for d4um5b_:

• d4um5b_ first appeared in SCOPe 2.05
  
• d4um5b_ appears in SCOPe 2.06