Lineage for d1qrsa1 (1qrs A:339-547)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16214Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
  4. 16215Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 16222Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
  6. 16223Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
  7. 16224Species Escherichia coli [TaxId:562] [50721] (10 PDB entries)
  8. 16226Domain d1qrsa1: 1qrs A:339-547 [26941]
    Other proteins in same PDB: d1qrsa2

Details for d1qrsa1

PDB Entry: 1qrs (more details), 2.6 Å

PDB Description: glutaminyl-trna synthetase mutant d235n complexed with glutamine transfer rna

SCOP Domain Sequences for d1qrsa1:

Sequence, based on SEQRES records: (download)

>d1qrsa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1qrsa1 b.53.1.2 (A:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlgvihwvsaahalpvei
rlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsr
hstaekpvfnrtvglrdt

SCOP Domain Coordinates for d1qrsa1:

Click to download the PDB-style file with coordinates for d1qrsa1.
(The format of our PDB-style files is described here.)

Timeline for d1qrsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qrsa2