SCOPe 2.05: Domain d4uecc_: 4uec C:

Lineage for d4uecc_ (4uec C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (7 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (6 PDB entries)

8. Domain d4uecc_: 4uec C: [269408]
   automated match to d2v8ye1
   complexed with mgt

Details for d4uecc_

PDB Entry: 4uec, 2.4 Å

PDB Description: complex of d. melanogaster eif4e with eif4g and cap analog

PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4uecc_:

Sequence; same for both SEQRES and ATOM records:

>d4uecc_ d.86.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
phmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdys
lfkknirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavi
nirgksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmv

Timeline for d4uecc_:

• d4uecc_ is new in SCOPe 2.05-stable
  
• d4uecc_ is called d4uecc1 in SCOPe 2.06
  
• d4uecc_ appears in the current release, SCOPe 2.08, called d4uecc1