SCOPe 2.08: Domain d4ue8a1: 4ue8 A:69-234

Lineage for d4ue8a1 (4ue8 A:69-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)

8. Domain d4ue8a1: 4ue8 A:69-234 [269407]
   Other proteins in same PDB: d4ue8a2
   automated match to d2v8ye1
   complexed with na, p4g

Details for d4ue8a1

PDB Entry: 4ue8, 1.1 Å

PDB Description: complex of d. melanogaster eif4e with the 4e binding protein thor

PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4ue8a1:

Sequence, based on SEQRES records:

>d4ue8a1 d.86.1.0 (A:69-234) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdt

Sequence, based on observed residues (ATOM records):

>d4ue8a1 d.86.1.0 (A:69-234) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendmqneitsfdtvedfwslynhikppseiklgsdyslfkknirpmw
edaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinirgksnkis
iwtadgnneeaaleighklrdalrlgrnnslqyqlhkdt

Timeline for d4ue8a1:

• d4ue8a1 first appeared in SCOPe 2.05, called d4ue8a_
  
• d4ue8a1 appears in SCOPe 2.07