SCOPe 2.08: Domain d4ueca1: 4uec A:69-236

Lineage for d4ueca1 (4uec A:69-236)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.86: eIF4e-like [55417] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478

4. Superfamily d.86.1: eIF4e-like [55418] (3 families)

5. Family d.86.1.0: automated matches [191459] (1 protein)
   not a true family

6. Protein automated matches [190708] (10 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [256194] (8 PDB entries)

8. Domain d4ueca1: 4uec A:69-236 [269406]
   Other proteins in same PDB: d4ueca2, d4uecc2
   automated match to d2v8ye1
   complexed with mgt

Details for d4ueca1

PDB Entry: 4uec, 2.4 Å

PDB Description: complex of d. melanogaster eif4e with eif4g and cap analog

PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d4ueca1:

Sequence; same for both SEQRES and ATOM records:

>d4ueca1 d.86.1.0 (A:69-236) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
khplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdyslfk
knirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinir
gksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmv

Timeline for d4ueca1:

• d4ueca1 first appeared in SCOPe 2.05, called d4ueca_
  
• d4ueca1 appears in SCOPe 2.07