![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
![]() | Protein automated matches [190110] (7 species) not a true protein |
![]() | Species Desulfovibrio fructosivorans [TaxId:878] [269393] (2 PDB entries) |
![]() | Domain d4ucxa_: 4ucx A: [269402] Other proteins in same PDB: d4ucxq_, d4ucxr_, d4ucxs_ automated match to d4urhc_ complexed with f3s, fco, gol, mg, ni, sf4; mutant |
PDB Entry: 4ucx (more details), 1.95 Å
SCOPe Domain Sequences for d4ucxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ucxa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosivorans [TaxId: 878]} akhrpsvvwlhnaecggcteaairtikpyidalildtisldyqetimaaageaaeaalhq alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag hpclgcsepdfwdtmtpfyeqg
Timeline for d4ucxa_: